augustus-gene-calls

TXT

A TXT-type anvi’o artifact. This artifact is typically provided by the user for anvi’o to import into its databases, process, and/or use.

🔙 To the main page of anvi’o programs and artifacts.

Provided by

There are no anvi’o tools that generate this artifact, which means it is most likely provided to the anvi’o ecosystem by the user.

Required by

anvi-script-augustus-output-to-external-gene-calls

Description

A gene call file from AUGUSTUS.

AUGUSTUS is a tool to predict genes from a variety of Eurkaryotic genomes. This includes predicting the 5’ UTR and 3’ UTR, as well as introns. You can search a sequence in the Augustus web interface. After a search, you can export the results as a .gff text file.

As of now, Anvi’o (specifically anvi-script-augustus-output-to-external-gene-calls) is only tested with AUGUSTUS v3.3.3. Feel free to be adventurous and try other versions if you feel so inclined.

You can convert this file into an anvi’o external-gene-calls file using anvi-script-augustus-output-to-external-gene-calls.

Here is an example of a .gff file for the Homo sapiens RNAP III subunit D sequence:

# This output was generated with AUGUSTUS (version 3.3.3).
# AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initializing the parameters using config directory /data/www/augustus/augustus/config/ ...
# human version. Using default transition matrix.
# Looks like /data/www/augustus/webservice/data/AUG-707407769/input.fa is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 5336, name = unnamed-1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
unnamed-1    AUGUSTUS    gene    57    1253    1    +    .    g1
unnamed-1    AUGUSTUS    transcript    57    1253    1    +    .    g1.t1
unnamed-1    AUGUSTUS    start_codon    57    59    .    +    0    transcript_id "g1.t1"; gene_id "g1";
unnamed-1    AUGUSTUS    single    57    1253    1    +    0    transcript_id "g1.t1"; gene_id "g1";
unnamed-1    AUGUSTUS    CDS    57    1253    1    +    0    transcript_id "g1.t1"; gene_id "g1";
unnamed-1    AUGUSTUS    stop_codon    1251    1253    .    +    0    transcript_id "g1.t1"; gene_id "g1";
# coding sequence = [atgtcggaaggaaacgccgccggcgagcccagcacgccgggagggccccgacctctcctgactggggcccgggggctca
# tcgggcggcggccggcgcctcccctcacccccggccgccttccctccatccgttccagggacctcaccctcgggggagtcaagaagaaaaccttcacc
# ccaaatatcatcagtcggaagatcaaggaagagcccaaggaagaagtaactgtcaagaaggagaagcgtgaaagggacagagaccgacaacgagaggg
# gcatggacgagggcgaggccgtccagaagtgatccagtctcactccatctttgagcagggcccagctgaaatgatgaagaaaaaagggaactgggata
# agacagtggatgtgtcagacatgggaccttctcatatcatcaacatcaaaaaagagaagagagagacagacgaagaaactaaacagatcttgcgtatg
# ctggagaaggacgatttcctcgatgaccccggcctgaggaacgacactcgaaatatgcctgtgcagctgccgctggctcactcaggatggctttttaa
# ggaagaaaatgacgaaccagatgttaaaccttggctggctggccccaaggaagaggacatggaggtggacatacctgctgtgaaagtgaaagaggagc
# cacgagatgaggaggaagaggccaagatgaaggctcctcccaaagcagccaggaagactccaggcctcccgaaggatgtatctgtggcagagctgctg
# agggagctgagcctcaccaaggaagaggaactgctgtttctgcagctgccagacaccctccctggccagccacccacccaggacatcaagcctatcaa
# gacagaggtgcagggcgaggacggacaggtggtgctcatcaagcaggagaaagaccgagaagccaaattggcagagaatgcttgtaccctggctgacc
# tgacagagggtcaggttggcaagctactcatccgcaagtctggaagggtgcaactcctcttgggcaaggtgactctggacgtgaccatgggaactgcc
# tgctccttcctgcaggagctggtgtccgtgggccttggagacagtaggacaggggagatgacagtcctgggacacgtgaagcacaaacttgtatgttc
# ccctgattttgaatccctcttggatcacaaacaccggtaa]
# protein sequence = [MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVK
# KEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNM
# PVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDT
# LPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGE
# MTVLGHVKHKLVCSPDFESLLDHKHR]
# end gene g1
###
# command line:
# /data/www/augustus/augustus/bin/augustus --species=human --strand=both --singlestrand=false --genemodel=partial --codingseq=on --sample=100 --keep_viterbi=true --alternatives-from-sampling=true --minexonintronprob=0.2 --minmeanexonintronprob=0.5 --maxtracks=2 /data/www/augustus/webservice/data/AUG-707407769/input.fa --exonnames=on

Edit this file to update this information.