Generate a new anvi'o contigs database.
🔙 To the main page of anvi’o programs and artifacts.
The input for this program is a contigs-fasta, which should contain one or more sequences. These sequences may belong to a single genome or could be many contigs obtained from an assembly or a single sequence of any kind.
Make sure the input file matches the requirements of a contigs-fasta. If you are planning to use the resulting contigs-db with anvi-profile, it is essential that you convert your fasta file to a properly formatted contigs-fasta before you perform the read recruitment.
The contigs database is one of the most essential components of anvi’o, and a contigs database will keep all the information related to your sequences: positions of open reading frames, k-mer frequencies for each contig, functional and taxonomic annotation of genes, etc.
When run on a contigs-fasta this program will,
Compute k-mer frequencies for each contig (the default is 4, but you can change it using --kmer-size parameter if you feel adventurous).
Soft-split contigs longer than 20,000 bp into smaller ones (you can change the split size using the --split-length flag). When the gene calling step is not skipped, the process of splitting contigs will consider where genes are and avoid cutting genes in the middle. For very, very large assemblies this process can take a while, and you can skip it with --skip-mindful-splitting flag.
Identify open reading frames using pyrodigal-gv which is an extension of pyrodigal (doi:10.21105/joss.04296) (which builds upon prodigal, the approach originally implemented by Hyatt et al (doi:10.1186/1471-2105-11-119).
Additionally, it includes metagenomics models for giant viruses and viruses with alternative genetic codes by Camargo et al doi:10.1038/s41587-023-01953-y. UNLESS, (1) you have used the flag --skip-gene-calling (no gene calls will be made) or (2) you have provided external-gene-calls. See other details related to gene calling below.
This program can work with compressed input FASTA files (i.e., the file name ends with a .gz extention).
The simplest form of this command that will give you a contigs-db is the following:
anvi-gen-contigs-database -f contigs-fasta \ -o contigs-db
But we suggest you to explicitly assign a unique ‘project name’ for each contigs-db you are generating through the --project-name parameter. Project name becomes an idenfitier of a contigs-db for most downstream analyses, and when you are working with many contigs-db files, non-unique names for each one of them may lead to various issues. Here is an example for a single genome:
anvi-gen-contigs-database -f Patient_6557_E_faecalis_cultivar.fa \ --project-name E_faecalis_P6557 \ -o E_faecalis_P6557.db
and a metagenome:
anvi-gen-contigs-database -f scaffolds.fa \ --project-name North_Atlantic_MGX_004 \ -o North_Atlantic_MGX_004.db
To shorten the runtime, you can also multithread anvi-gen-contigs-database with the -T flag followed by the desired number of threads, depending on your system.
There are a myriad of programs you can run on a contigs-db once it is created to add more and more layers of information on it. Please see the artifact contigs-db to see a list of steps you can follow.
anvi-gen-contigs-database -f contigs-fasta \ -o contigs-db \ --external-gene-calls external-gene-calls
See external-gene-calls for the description and formatting requirements of this file.
If user-provided or anvi’o-calculated amino acid sequences contain internal stop codons, anvi’o will yield an error. The following command will persist through this error:
anvi-gen-contigs-database -f contigs-fasta \ -o contigs-db \ --external-gene-calls external-gene-calls \ --ignore-internal-stop-codons
By default, this program will use pyrodigal for gene calling, and the key aspects of the resulting information about genes in input sequences are stored in the resulting contigs-db files. That said, gene calls include much more information than what will be stored in the database. If you need a more comprehensive report on gene calls, you can run anvi-gen-contigs-database with the following parameter:
anvi-gen-contigs-database -f contigs-fasta \ -o contigs-db \ --full-gene-calling-report OUTPUT.txt
In this case the OUTPUT.txt will contain additional data, and the gene caller ids will match to those that are stored in the database therefore tractable all downstream analyses that will stem from the resulting contigs-db. Here is a snippet from an example file:
| gene_callers_id | contig | start | stop | direction | partial | partial_begin | partial_end | confidence | gc_cont | rbs_motif | rbs_spacer | score | cscore | rscore | sscore | start_type | translation_table | tscore | uscore | sequence | translated_sequence |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 0 | NC_009091 | 169 | 1327 | f | False | False | False | 99.99 | 0.3013 |  |  | 153.96808116167358 | 151.14841116167358 | -0.9874499999999999 | 2.8196700000000003 | ATG | 11 | 2.8971 | 0.9100200000000003 | ATGGAAATTATTTGTAATCAAAATGAATTA(…) | MEIICNQNELNNAIQLVSKAVASRPTHPIL(…) |
| 1 | NC_009091 | 1388 | 2036 | f | False | False | False | 99.99 | 0.2885 | GGA/GAG/AGG | 5-10bp | 81.87259573141999 | 71.58136573142 | 2.71875 | 10.291229999999999 | ATG | 11 | 2.8971 | 4.67538 | ATGGTCCTTAATTATGGAAATGGTGAAAAT(…) | MVLNYGNGENVWMHPPVHRILGWYSRPSNL(…) |
| 2 | NC_009091 | 2039 | 4379 | f | False | False | False | 99.99 | 0.3260 | GGA/GAG/AGG | 5-10bp | 352.2303246874159 | 347.0894946874159 | 2.71875 | 5.14083 | ATG | 11 | 2.8971 | -0.47502 | ATGATAAATCAAGAAAATAATGATCTATAT(…) | MINQENNDLYDLNEALQVENLTLNDYEEIC(…) |
| 3 | NC_009091 | 4426 | 5887 | f | False | False | False | 99.99 | 0.3347 |  |  | 194.19481790304437 | 188.61028790304437 | -0.9874499999999999 | 5.584530000000002 | ATG | 11 | 2.8971 | 3.6748800000000017 | ATGTGCGGAATAGTTGGAATCGTTTCTTCA(…) | MCGIVGIVSSDDVNQQIYDSLLLLQHRGQD(…) |
| 4 | NC_009091 | 5883 | 8325 | r | False | False | False | 99.99 | 0.2731 |  |  | 318.93104438253084 | 315.33533438253085 | -0.9874499999999999 | 3.5957100000000004 | ATG | 11 | 2.8971 | 1.6860600000000003 | ATGGATAAGAAAAACTTCACTTCTATCTCA(…) | MDKKNFTSISLQEEMQRSYLEYAMSVIVGR(…) |
| 5 | NC_009091 | 8402 | 9266 | r | False | False | False | 99.99 | 0.2719 |  |  | 99.52927145207937 | 93.12346145207937 | -0.9874499999999999 | 6.405809999999998 | ATG | 11 | 2.8971 | 4.496159999999998 | ATGAAAAAGTTTTTACAAAGAATACTCTGG(…) | MKKFLQRILWISLISFYFLQIKKVQAIVPY(…) |
| 6 | NC_009091 | 9262 | 10219 | r | False | False | False | 99.99 | 0.3239 |  |  | 107.44082411540528 | 104.45237411540528 | -0.9874499999999999 | 2.9884500000000003 | ATG | 11 | 2.8971 | 1.0788000000000002 | ATGATTAATAGGATTCAAGACAAAAAAGAA(…) | MINRIQDKKEISKKLKERAIFEGFTIAGIA(…) |
| 7 | NC_009091 | 10365 | 11100 | f | False | False | False | 99.99 | 0.3319 |  |  | 71.66956065705634 | 79.71184065705633 | -0.9874499999999999 | -8.042279999999998 | TTG | 11 | -9.60915 | 2.55432 | TTGGTTGAATCTAATCAAAATCAAGATTCC(…) | MVESNQNQDSNLGSRLQQDLKNDLIAGLLV(…) |
| 8 | NC_009091 | 11103 | 11721 | f | False | False | False | 99.99 | 0.2993 |  |  | 69.10757680331382 | 69.03014680331381 | -0.9874499999999999 | 0.07743000000000055 | ATG | 11 | 2.8971 | -1.8322199999999995 | ATGCATAATAGATCTCTTTCTAGAGAATTA(…) | MHNRSLSRELSLISLGLIKDKGDLKLNKFQ(…) |
| (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) | (…) |
You can change the k-mer size by modifying the --kmer-size parameter:
anvi-gen-contigs-database -f contigs-fasta \ -o contigs-db \ --kmer-size 3
A word of caution: you can increase the k-mer size up to a maximum of k=5 for standard installations of anvi’o. This is because the contigs database stores the k-mer frequencies in a big table with one column per k-mer, and SQLite has an upper limit on the number of columns per table. The default limit is 2,000 columns, which translates into an upper limit of k=5 (with 4^5 = 1,096 possible k-mers). Trying to increase k beyond this point will result in the following error: sqlite3.OperationalError: too many columns on kmer_contigs.
If you want to increase k even further, you can re-compile the sqlite3 library to increase the column limit (the constant SQLITE_MAX_COLUMN). Note that you can only increase this limit up to a maximum of 32,000 columns, which makes k=7 (with 4^7 = 16,384 possible k-mers) the new upper limit for k-mer size.
Increasing the k-mer size limit to k=7
Sebastian Treitli shared his workflow for re-compiling sqlite3 with larger column limits on Discord (here is the link to the relevant message). Here are the initial steps, which are based on this StackExchange thread:
tar -xvzf "sqlite-snapshot-202405081757.tar.gz"cd sqlite-snapshot-202405081757./configureMakefile. Find inside the Makefile the line that starts with DEFS = and append to this line -DSQLITE_MAX_COLUMN=32767. Save the filemake to compileAfter this, the newly-compiled library has to be moved into your anvi’o environment, at the same location where the original library was installed. This step will differ for everyone depending on their anvi’o installation, but we assume that if you are at this point, you probably know what you are doing :)
lib directory, which would look something like this (paths are not exact and depend on your system/anvi’o installation): cp /path/to/compiled/sqlite/.libs/libsqlite3.so.0.8.6 /home/user/miniconda3/envs/anvio-7.1/lib/libsqlite3.so.0.8.6bin directory, which would look something like this (paths are not exact and depend on your system/anvi’o installation): cp /path/to/compiled/sqlite/sqlite3 /home/user/miniconda3/envs/anvio-7.1/bin/sqlite3Edit this file to update this information.
Are you aware of resources that may help users better understand the utility of this program? Please feel free to edit this file on GitHub. If you are not sure how to do that, find the __resources__ tag in this file to see an example.